PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG017923.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 1131aa    MW: 124702 Da    PI: 5.7612
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG017923.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-53171432128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  ppGfrFhPtdeelvv+yLk+k+ +k+l+l ++i+evd+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nrat++gyWkatgkd+ v+s ++
  CCG017923.1  17 PPGFRFHPTDEELVVYYLKRKICKKRLKL-NIIREVDVYKWDPEELPgQsILKTGDRQWFFFSPRDRKYPNGARSNRATRQGYWKATGKDRIVVS-NS 112
                  8****************************.89**************96446788999************************************99.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kktLvfy+grap+ge+tdWvmhey+l
  CCG017923.1 113 RNVGVKKTLVFYRGRAPNGERTDWVMHEYSL 143
                  9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6110166IPR003441NAC domain
PROSITE profilePS5100556.52416166IPR003441NAC domain
PfamPF023654.4E-2817143IPR003441NAC domain
PROSITE profilePS5010217.762595673IPR000504RNA recognition motif domain
CDDcd126713.53E-47596671No hitNo description
SMARTSM003603.0E-25596669IPR000504RNA recognition motif domain
SuperFamilySSF549286.18E-28598689IPR012677Nucleotide-binding alpha-beta plait domain
Gene3DG3DSA:3.30.70.3301.3E-26598688IPR012677Nucleotide-binding alpha-beta plait domain
PfamPF000764.3E-21598667IPR000504RNA recognition motif domain
PfamPF143275.1E-18746816IPR025742Cleavage stimulation factor subunit 2, hinge domain
PfamPF143045.3E-1010921125IPR026896Transcription termination and cleavage factor, C-terminal domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0031124Biological ProcessmRNA 3'-end processing
GO:0000166Molecular Functionnucleotide binding
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1131 aa     Download sequence    Send to blast
MTVTTDSCFG ADDKEWPPGF RFHPTDEELV VYYLKRKICK KRLKLNIIRE VDVYKWDPEE  60
LPGQSILKTG DRQWFFFSPR DRKYPNGARS NRATRQGYWK ATGKDRIVVS NSRNVGVKKT  120
LVFYRGRAPN GERTDWVMHE YSLDEEELKR CSNVQDYYAL YKVYKKSGAG PKNGEHYGAP  180
FKEEDWADDE SQCVNGMFTP EIPVKQQHNE VTLVDNFIQS AQPELPLNDF EEIIKPIGEE  240
PAHNELQNNG FTNLLPQVTG EEEAQSTLVD PSFREFVCEP AGELTTSGQH CNKHTSFNFD  300
QSGTSTLQLR EAPEVTSGTN YKQAPQLNEE DFLEINDLID PEPSFSNTEQ PLENLQFGDF  360
DGLSEFDLYH DAAMFLRDMG PVDQEAVSHS YMHPYGRDMV NQVGCQLQPD SIINVVDYQL  420
QQSNLVANQV DCDLQPQFFD AEQMNNQLWV HGQRSNMLAA SESHNGNLFQ PTPGVVCESS  480
NNSTRTNENQ GGKEGDAADG WFSSALWGFV ESIPTNPASA SENPLVNKAF ERMSSLSRIR  540
MNVKSINVDA ASRIRMNVNS INVVAANGAA SVRSASRNKG FVLLSIVGVL CAILWVFVVG  600
NIPYDATEEQ LIEICREVGP VVSFRLVIDR ETGKPKGYGF CEYKDEETAL SARRNLQGYE  660
INGRQLRVDF AENDKNADRN REQGRGGPRL AANIDPQKQV GGPAILEEPA QHQPIGLHIA  720
ITAATVMAGT LGGAQTVMHS NQNGLQSQPA LASDPLTLHL AKMSRNQLNE IMSELKGMAT  780
QNREAAHQLL LGKPQLSKAL FQAQIMLGMV TPQVLQLPNI RQSTGQPALS SLQDSQQVQR  840
PAVPNLPGLP PTAQRMQLGL GQFSAGPQPS VQPQKSLVHN QFSATPQPSV QAQTQMPHHN  900
NHVTHHATLL GQSAPLPAAL PSVRPPVQMA NSSPLNQQMQ PSLVQHTGQV GNASARHNPQ  960
MVLPNKAMQS SLLSRPPATG SFQSGLPVSS GISDAANADR STLRSNAYLN MQTSTAHDSK  1020
EPINRPSKVL KLDDGRSMSV PMGGSNMFSA TGSGPSQAPA VNSVPPNPLP RPEELQHSGK  1080
QVPQLPADIE SALLQQVLNL TPEQLSSLPP DQQQQVIQLQ QALRRDQMQP S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-511717221174NAC domain-containing protein 19
3swm_B5e-511717221174NAC domain-containing protein 19
3swm_C5e-511717221174NAC domain-containing protein 19
3swm_D5e-511717221174NAC domain-containing protein 19
3swp_A5e-511717221174NAC domain-containing protein 19
3swp_B5e-511717221174NAC domain-containing protein 19
3swp_C5e-511717221174NAC domain-containing protein 19
3swp_D5e-511717221174NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13443KRKICKKRLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026293.10.0PREDICTED: NAC domain-containing protein 74-like isoform X2
TrEMBLB9GT490.0B9GT49_POPTR; No apical meristem family protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-138NAC domain containing protein 17